PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010543777.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB
Protein Properties Length: 560aa    MW: 62192.9 Da    PI: 6.5984
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010543777.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-173986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt Ed  l+d+vk++G g+W+++ ++ g+ R++k+c++rw ++l
   XP_010543777.1 39 KGPWTTAEDAVLIDYVKKHGEGNWNAVQKYTGLSRCGKSCRLRWANHL 86
                     79******************************************9986 PP

2Myb_DNA-binding53.17.5e-1792135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l+v++++++G++ W++ a++++ gRt++++k++w++
   XP_010543777.1  92 KGAFSQEEEQLIVELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 135
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1153486IPR017930Myb domain
SuperFamilySSF466892.02E-3037133IPR009057Homeodomain-like
SMARTSM007171.0E-143888IPR001005SANT/Myb domain
PfamPF002491.7E-153986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-234093IPR009057Homeodomain-like
CDDcd001673.27E-114186No hitNo description
PROSITE profilePS5129426.26587141IPR017930Myb domain
SMARTSM007177.8E-1791139IPR001005SANT/Myb domain
PfamPF002491.3E-1592135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2594140IPR009057Homeodomain-like
CDDcd001674.24E-1294135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MSHTMDESDN GMYNKRDESP AAENGSGCRS RWAGTVLKKG PWTTAEDAVL IDYVKKHGEG  60
NWNAVQKYTG LSRCGKSCRL RWANHLRPNL KKGAFSQEEE QLIVELHAKM GNKWARMAAH  120
LPGRTDNEIK NYWNTRIKRR QRAGLPLYPP EMHVEALQWN QEFTESDQRY QDFLQVGSCE  180
PNVLFDSLKV VSGMVPSASD LSDVASCNML GNNGASSSCY KGFRPPIMQP TKRFREQGAI  240
LPVYCSNIKD EFPSLEEIQS TAPRKISKSF SFSFPRDTDP PNRVQHYSDV IPGSHTLMDA  300
IFPSSKPSFG TVKLELPSFQ YPETNFDQLK ASLSPHSDLL ESVDAFFQFP PTMRKLEADC  360
YSSCDTGLLD MLLHEAKIRT GTKTGSLLSE KSFCSTTTPE MAEGITHVKP ETKHKESEVS  420
IKPSTHSGIP FSVQLGEGGS SSGESSLPTH NFSGHNNVKI EQWDQIWTPK RENEKNPVLD  480
ISRPDVLLAS SWLDHGLGLV KETTTMSDAL VALFGDEFGN EHMHMAVGTP SSSSSSGQAR  540
AVGSCVWSNM PPVCQMTELP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-302814013127MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195853e-97AY519585.1 Arabidopsis thaliana MYB transcription factor (At3g11440) mRNA, complete cds.
GenBankBT0039403e-97BT003940.1 Arabidopsis thaliana clone RAFL15-06-P04 (R20731) putative Myb DNA-binding protein (At3g11440) mRNA, complete cds.
GenBankBT0051203e-97BT005120.1 Arabidopsis thaliana clone U20731 putative Myb DNA-binding protein (At3g11440) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010543781.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_010543780.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_010543779.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_010543778.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_010543777.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLR0H6G30.0R0H6G3_9BRAS; Transcription factor
STRINGfgenesh2_kg.3__1182__AT3G11440.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.30.0myb domain protein 33